PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm_27.model.AmTr_v1.0_scaffold00059.125
Common NameAMTR_s00059p00141510
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; basal Magnoliophyta; Amborellales; Amborellaceae; Amborella
Family HD-ZIP
Protein Properties Length: 188aa    MW: 21766.7 Da    PI: 9.9088
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm_27.model.AmTr_v1.0_scaffold00059.125genomeTAGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.81e-193588457
                                              -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                                  Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                              ++++++eq+  Le  F +++++  e++++LA++lgL+ rqV vWFqNrRa++k+
  evm_27.model.AmTr_v1.0_scaffold00059.125 35 KRRLSAEQVSFLEMNFGSQQKLESERKAKLASELGLDPRQVAVWFQNRRARWKN 88
                                              5689************************************************95 PP

2HD-ZIP_I/II1215.9e-3934124292
                               HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkray 70 
                                               kkrrls+eqv++LE++F +++kLe+erK++la+eLgl+prqvavWFqnrRAR+k+kqlE+d + Lk++y
  evm_27.model.AmTr_v1.0_scaffold00059.125  34 KKRRLSAEQVSFLEMNFGSQQKLESERKAKLASELGLDPRQVAVWFQNRRARWKNKQLEEDLKLLKSQY 102
                                               9******************************************************************** PP

                               HD-ZIP_I/II  71 dalkeenerLekeveeLreelk 92 
                                               +a ++e+++Le+ev eLre+l+
  evm_27.model.AmTr_v1.0_scaffold00059.125 103 EAAANEKRELEAEVMELREKLS 124
                                               ******************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.1672989IPR001356Homeobox domain
SMARTSM003893.1E-183193IPR001356Homeobox domain
SuperFamilySSF466894.71E-183398IPR009057Homeodomain-like
CDDcd000861.51E-153490No hitNo description
PfamPF000464.4E-173588IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-203695IPR009057Homeodomain-like
PRINTSPR000312.3E-66069IPR000047Helix-turn-helix motif
PROSITE patternPS0002706487IPR017970Homeobox, conserved site
PRINTSPR000312.3E-66985IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MSMLFYSGSY PSPKKDVRQR RRRKKGKGTE SELKKRRLSA EQVSFLEMNF GSQQKLESER  60
KAKLASELGL DPRQVAVWFQ NRRARWKNKQ LEEDLKLLKS QYEAAANEKR ELEAEVMELR  120
EKLSVAENEI VRLTEGSNVT SKAEKSSSPS SSLMGDFEPE QPNNFMIMPD NISINTLEWF  180
NYYANLF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12036RRRKKGKGTESELKKRR
22236RKKGKGTESELKKRR
38189RRARWKNKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00473DAPTransfer from AT4G36740Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006856113.21e-134PREDICTED: homeobox-leucine zipper protein ATHB-40 isoform X1
TrEMBLU5D5T91e-134U5D5T9_AMBTC; Uncharacterized protein
STRINGPOPTR_0005s12760.14e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP37761025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-39homeobox protein 40
Publications ? help Back to Top
  1. Amborella Genome Project
    The Amborella genome and the evolution of flowering plants.
    Science, 2013. 342(6165): p. 1241089
    [PMID:24357323]